SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81298920|ref|YP_399128.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81298920|ref|YP_399128.1|
Domain Number 1 Region: 16-167
Classification Level Classification E-value
Superfamily Ferritin-like 1.89e-47
Family Ferritin 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81298920|ref|YP_399128.1|
Sequence length 168
Comment DNA-binding ferritin-like protein [Synechococcus elongatus PCC 7942]
Sequence
MGKKSEGKKAATLPVDIGISNDDRQAIADGLSRLLADTYTLYLKTHNFHWNVTGPMFQTL
HLLFETQYNELALAVDLIAERIRALGFPAPGSYSAYAKLTSIEEADGIPSATEMIQQLVI
GQETVVRTARALFPIVDAASDEPTADLLTQRMQIHEKNAWMLRSLLES
Download sequence
Identical sequences Q31S28
gi|81298920|ref|YP_399128.1| 1140.Synpcc7942_0109 WP_011377445.1.45845 WP_011377445.1.5740 WP_011377445.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]