SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81298954|ref|YP_399162.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81298954|ref|YP_399162.1|
Domain Number 1 Region: 6-202
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.87e-67
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000564
Further Details:      
 
Domain Number 2 Region: 186-322
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.58e-42
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81298954|ref|YP_399162.1|
Sequence length 326
Comment pyruvate/2-oxoglutarate dehydrogenase complex dehydrogenase (E1) component [Synechococcus elongatus PCC 7942]
Sequence
MAETFMFNALRAAIDEEMARDPNVFVLGEDVGHYGGSYKVTKDLYQKYGDFRLLDTPIAE
NGFTGMAVGAAMTGLRPIVEGMNMGFLLLAFNQIANNAMLRYTSGGNFTIPIVFRGPGGV
GRQLGAEHSQRLEAYFHAVPGLKIVACSTPYNAKGLLKAAIRDNNPVLFFEHVLLYNLKE
DLPDEEYICPLDKAEIVRPGKDVTVLTYSRMRYHCLQAVKTLEKEGFDPEVIDLISLKPF
DFEAIEASVRKTHRVVIVEECMKTGGIAAELSAAIMERCFDELDAPVVRLSSQDIPTPYN
GKLENLTIVQPEQIVAAVKDLLTAKV
Download sequence
Identical sequences Q31RZ4
gi|81298954|ref|YP_399162.1| 1140.Synpcc7942_0143 WP_011377464.1.45845 WP_011377464.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]