SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299114|ref|YP_399322.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299114|ref|YP_399322.1|
Domain Number 1 Region: 138-280
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.51e-39
Family Potassium channel NAD-binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 39-160
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-17
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 3 Region: 285-369
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.00000000000000432
Family TrkA C-terminal domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299114|ref|YP_399322.1|
Sequence length 384
Comment response regulator receiver domain-containing protein [Synechococcus elongatus PCC 7942]
Sequence
MLDTVPIDRLRLEHKHPSRPDAMTAGSPRRSLPPALRKVVIGGLFFLATQAIAILGYWLS
GWSLLDAIYMVVITIFGVGYGEVRPINTPALRIFTIFVILAGTSSAVYLIGGLAQLVTEG
EIRRALGVRRMTREIRTLQRHVIVCGFGRIGQTLARKVTEASLPVIVIDTDETRIRQAEE
QGFLALRGSATDEAILIDAGVERAATIATALPDDAANVFITLTARGLNPNLTIIARGELP
ATEKKLLQAGADRVVLPATIGALRMAHLITHPAALNLLESSDSHQTLNELLGELDIQMDE
LAIAPQSPLIGHRLGAIEVSGKGAFIIVALRRATGEMILRPGSDLFLHAGDTLIVIGHSG
DLPRFAKHYALQRQVQYRGVRQRS
Download sequence
Identical sequences Q31RI4
gi|81299114|ref|YP_399322.1| 1140.Synpcc7942_0303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]