SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299222|ref|YP_399430.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299222|ref|YP_399430.1|
Domain Number 1 Region: 1-256
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.83e-93
Family Tryptophan biosynthesis enzymes 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299222|ref|YP_399430.1|
Sequence length 266
Comment tryptophan synthase subunit alpha [Synechococcus elongatus PCC 7942]
Sequence
MTAISDCFAALRSQGRCALIPFLTAGDPDLETTRQALLALDREGADLIELGVPYSDPLAD
GPVIQAAATRALQAGTRLDDVLALLKDVRSQIKAPIVLFTYCNPILNRGFEAFLDQIAAA
GANGLVVPDLPLEESQRLSEVAAERGIDLILLIAPTSSADRIAAISKQARGFIYLVSVTG
VTGMRQGMQSRVADLLQEIRQGTDKPIGVGFGISGAEQARQVRDWGADGVIVGSAFVNRL
QEQGVEGVATLCRELRQAIDRQPVLS
Download sequence
Identical sequences Q31R76 Q5N324
1140.Synpcc7942_0411 269084.syc1106_d gi|56751115|ref|YP_171816.1| WP_011243417.1.45845 WP_011243417.1.5740 WP_011243417.1.95485 gi|81299222|ref|YP_399430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]