SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299241|ref|YP_399449.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299241|ref|YP_399449.1|
Domain Number 1 Region: 2-350
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.66e-76
Family TK-like PP module 0.0069
Further Details:      
 
Domain Number 2 Region: 290-479
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.24e-64
Family TK-like Pyr module 0.0088
Further Details:      
 
Domain Number 3 Region: 493-625
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.7e-35
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299241|ref|YP_399449.1|
Sequence length 636
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Synechococcus elongatus PCC 7942]
Sequence
MHLSEITHPNQLHGLSVAQLEQIGHQIREKHLQTVAATGGHLGPGLGVVELTLALYQTLD
LDRDKVVWDVGHQAYPHKLLTGRYHNFHTLRQKDGIAGYLKRTENRFDHFGAGHASTSIS
AALGMALARDAQGEDYRCVAVIGDGSLTGGMALEAINHAGHLPKTRLLVVLNDNDMSISP
NVGALSRYLNKIRVSEPMQLLTDGLTQGMQQIPFVGGAITQGFEPVKEGMKRLSYSKIGA
VFEELGFTYMGPVDGHNLEELIATFREAHKHTGPVLVHVATTKGKGYPYAEEDQVGYHAQ
NPFDLATGKAKPASKPKPPSYSKVFGQTLTTLAKSDRRIVGITAAMATGTGLDILQKALP
KQYIDVGIAEQHAVVLAAGMACDGMRPVVAIYSTFLQRAFDQVIHDVCIQKLPVFFCLDR
AGIVGADGPTHQGMYDIAYLRLIPNMVLMAPKDEAELQRMLVTGIEYDGPIAMRFPRGNG
IGVPLPEEGWESLPIGKAEQLRQGDDLLMLAYGSMVYPALQTAELLNEHGISATVINARF
AKPLDEELIVPLARQIGKVVTFEEGCLPGGFGSAIMESLQAHDLQVPVLPIGVPDLLVEH
ASPDESKQELGLTPRQMADRILEKFGSRQRIGAASA
Download sequence
Identical sequences Q8GAA0
gi|81299241|ref|YP_399449.1| WP_011377576.1.45845 WP_011377576.1.95485 1140.Synpcc7942_0430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]