SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299345|ref|YP_399553.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299345|ref|YP_399553.1|
Domain Number 1 Region: 254-641
Classification Level Classification E-value
Superfamily SIS domain 1.76e-92
Family double-SIS domain 0.000000171
Further Details:      
 
Domain Number 2 Region: 2-243
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.8e-66
Family Class II glutamine amidotransferases 0.0000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81299345|ref|YP_399553.1|
Sequence length 641
Comment glucosamine--fructose-6-phosphate aminotransferase [Synechococcus elongatus PCC 7942]
Sequence
MCGIVGYIGTQPASHILLEGLRQLEYRGYDSAGIATLWDHQLQIVRAEGKLHNLQAALQN
HDSPAHLGIGHTRWATHGKPEVRNAHPHKDMSGLVAVVQNGIVENYRELREALQAEGIEF
VSDTDTEVIPNLVARHFRQLAAAGSAPDSRLLEAVRLAVQELEGAYAIAVLCVDAPDEIV
VARQQAPLVIGFGQGEFFCASDTPAIINHTRAVVTLENGEMARLTPLGVEIFNFQGDRLR
KQPRLLSGTSLLAEKQGFRHYMLKEIYDQPGVVRSWLSTHLNDNWRADAADEPAQVAPYP
HAQTPVILNLPDELLNDLEQVQILACGTSWHASLVGRYLLETLAGVPTQVYYASEFRYAP
SPLVRNTLTIGVTQSGETADTLAALEKEGERRSGLGPEFAPRLLGITNRSESTLAHVVPH
ILDIQAGIEVGVAATKTFLGQVLAFYGLAIDLAYRRSSQSHEKLEALIAGLKRIPDQIEQ
LLREQDGAIESLAHQFTETQDFIFMGRGINFPIALEGALKLKEISYIHAEGYPAGEMKHG
PIALLDSKVPVVAIAVPGSVYDKVLSNAQEAKARDARMIGVIPDGPDANMFDHYLWVPIV
DELLSPLLTVVPLQLLSYHIAALRGLDVDQPRNLAKSVTVE
Download sequence
Identical sequences A0A0H3K1S5 Q31QV3
gi|56750996|ref|YP_171697.1| WP_011243299.1.45845 WP_011243299.1.5740 WP_011243299.1.95485 1140.Synpcc7942_0534 269084.syc0987_d gi|81299345|ref|YP_399553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]