SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299346|ref|YP_399554.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299346|ref|YP_399554.1|
Domain Number 1 Region: 7-66
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.75e-16
Family 7-Fe ferredoxin 0.0000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299346|ref|YP_399554.1|
Sequence length 81
Comment photosystem I subunit VII [Synechococcus elongatus PCC 7942]
Sequence
MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIAASPRTEDCVGCKRCETACPT
DFLSIRVYLGAETTRSMGLAY
Download sequence
Identical sequences P31085 Q31QV2
gi|56750995|ref|YP_171696.1| WP_011243298.1.45845 WP_011243298.1.5740 WP_011243298.1.95485 gi|81299346|ref|YP_399554.1| 1140.Synpcc7942_0535 269084.syc0986_d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]