SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299349|ref|YP_399557.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299349|ref|YP_399557.1|
Domain Number 1 Region: 10-337
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.97e-119
Family TK-like PP module 0.000000000381
Further Details:      
 
Domain Number 2 Region: 341-531
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.57e-68
Family TK-like Pyr module 0.000000199
Further Details:      
 
Domain Number 3 Region: 537-667
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.37e-46
Family Transketolase C-terminal domain-like 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81299349|ref|YP_399557.1|
Sequence length 668
Comment transketolase [Synechococcus elongatus PCC 7942]
Sequence
MVVAAQSLDELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAYVLWDRFLRFNPKNPAWF
NRDRFVLSAGHGCMLQYALLHLSGYDSVSIEDIKNFRQWGSPTPGHPENFETPGVEVTTG
PLGQGIANAVGLALAEAHLAARFNKPDAKLVDHYTYVILGDGCNMEGISGEAASLAGHWG
LGKLIALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVENGNTDLAAIEKAIADAKA
VTDKPTLIKVTTTIGYGSPNKANTAGVHGAALGDAEIKLTRENLGWDYEPFVVPEDALAH
WRKAIERGAALESSWNETLAQYKANYPAEAAEFERMLSGQLPTGWADALPSYTPADKAVA
TRKHSEICLNALAPVLPELIGGSADLTHSNLTELHVSGDFQKGAYENRNVHFGVREHAMA
AIANGIALHNSGLIPYAATFLVFADYMRGAMRLSALSEVGVIYVLTHDSIGLGEDGPTHQ
PVETIASLRIIPNMLVFRPADGNEASGAYKVAVENRKRPSVLAMSRQNLPNLEGSSIDIV
AKGAYVLSDDEGTPDLILLATGSEVSLCVEAAKQLRAEGKKVRIVSMPCWELFDEQSAEY
KESVLPKAVTARLAVEAGSSFGWHRYVGDAGATISTDTFGASAPGNVMFEKFGFTVDNVV
AKAKAVIG
Download sequence
Identical sequences A0A0H3K2H1 Q31QU9
gi|56750992|ref|YP_171693.1| gi|81299349|ref|YP_399557.1| 1140.Synpcc7942_0538 269084.syc0983_c WP_011243295.1.45845 WP_011243295.1.5740 WP_011243295.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]