SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299381|ref|YP_399589.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|81299381|ref|YP_399589.1|
Domain Number - Region: 2-36
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.000863
Family Intein (protein splicing domain) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299381|ref|YP_399589.1|
Sequence length 447
Comment DNA polymerase III subunit alpha [Synechococcus elongatus PCC 7942]
Sequence
MVKIVRRRSLGVQPVYDLGVATVHNFVLANGLVASNCFNKSHSTAYGYVTFQTAYLKANF
PVEYMAALLTVNSGNADKVQKYIANCAAMGIEVLPPDINRSGVDFTPTGDRILFGLSAIR
NLGLGAIESILAARDVGGPFLSLADLCDRVDTGSLNRRAMESLIHAGALDVLETGANRQQ
LVADLPLVIDWANSRAKDRASGQGNLFDMLGSNDSNSSPLDTAPKAPAVPDYSPDEKLKL
EKELLGFYLSDHPLKVVQEPARLLAPASISDLEDYCDRGLISTIALLTEVKPVVTKKGDR
MAILRIEDLSGNTEAVVFPRSYERIGHYIEADARLMLWGKVDRRDDQVQFIIEDAEPIDH
VRLVLVELSVEQASDIVQQQRLKELLLQQKREEERSKVPVVAVIQAGSDRYFVRLGAQFR
VEDPEEAVEALQAADFQARAEALLSPA
Download sequence
Identical sequences A0A0H3K7V6 Q31QR7
gi|56750961|ref|YP_171662.1| 1140.Synpcc7942_0570 269084.syc0952_d gi|81299381|ref|YP_399589.1| WP_011243264.1.45845 WP_011243264.1.5740 WP_011243264.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]