SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299525|ref|YP_399733.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299525|ref|YP_399733.1|
Domain Number 1 Region: 387-565
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.34e-44
Family N-acetylmuramoyl-L-alanine amidase-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299525|ref|YP_399733.1|
Sequence length 568
Comment cell wall hydrolase/autolysin [Synechococcus elongatus PCC 7942]
Sequence
MFWLAQLPPLQVVYPADQQKTQADRIFLIGTADPRQTVTINGQLIQRSPAGHFAPSFPLQ
LGPNQFELRSGDQRLTLTVIRQAAQPALAPGTLLADLQPQQTIAVSPGQPVCFSAIAVPQ
AQIQVQIGSLQLPLQGQAIAPLPSNSAVLIGQNQPDRPAPIQRYEGCTTALAAGFQGQPQ
FQIQAGDRRLTQAAPGSVTVWPAQPYRVATVTAPEAIARTGPSTDHSRLTPLPQGTQAQV
LGQTGEWLQLAYGGWMRTSEARLTTSAALPRSQVRSASFQSRDRWLEFRVPLNRPAPLRL
EQQGDRLTLQLYETTAQTDTIRLSTDPWLRSFRWEQARPGEVTYHLQLASQQQWGYRLRY
DGNILVLSIRKPPTISQSRLQQPLRGLRIYLDPGHGSAEDLGARGPDGTPEKDVTLTVSN
LLRDRLQQLGAAVLMSRKGDEDIWPQERAAQIQALEPDIALSLHYNALPDAGDAEGTQGI
GAFWYQDQSQDLARSLHDSLVSRLQRPSYGIFWNNLALTRPTVAPSVLLELGFMINPREF
EWIVDLDAQSQLVEAIAQGLVDWFHSQP
Download sequence
Identical sequences A0A0H3K7E9 Q31QC3
gi|81299525|ref|YP_399733.1| gi|56750825|ref|YP_171526.1| 1140.Synpcc7942_0714 269084.syc0816_d WP_011243128.1.45845 WP_011243128.1.5740 WP_011243128.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]