SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299538|ref|YP_399746.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299538|ref|YP_399746.1|
Domain Number 1 Region: 10-106
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000000034
Family DNA primase zinc finger 0.028
Further Details:      
 
Weak hits

Sequence:  gi|81299538|ref|YP_399746.1|
Domain Number - Region: 485-633
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00139
Family Nucleotide and nucleoside kinases 0.068
Further Details:      
 
Domain Number - Region: 481-522
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00531
Family RecA protein-like (ATPase-domain) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299538|ref|YP_399746.1|
Sequence length 847
Comment hypothetical protein Synpcc7942_0727 [Synechococcus elongatus PCC 7942]
Sequence
MSRISDAARGRWPEILNKLGGVAPEFLVVSKTKESPCPCCGGETRYRFDDLDGNGTWFCS
HCGGRDQKGGGGTGFDLLMRLKGWDFSEAARQVEQFLGIKRDRPDPPIRGASAFWRYSDD
FYVIRWDKPGQKKSIRPCRWNGEKWEWKRPTGKLPLFNLDRLRALPDAVVIVVEGEKAAD
AAAKLFPNFVVTTWHGGTKNWQTADWSPLRGRKVALWPDADAVGIIAMQSIAGAIEAAEL
RLVRNPEGVPEAWDLADADWSPEHALNWLKANCYEPEPDLDPPACVEASEVENAEPSLEA
TSSGSEARSRSRDDDSLYTALGYDKDRYYYLPRGTKQIVELTANSHRKLNLIQIAPLNYW
EMTFPRKNGADWESAANWLMRECEAVGVFDPSRIRGRGAWWDDGKTILHLGGRLVVEGAE
TTSMTVRGSRYIYERAVDLQSFATTEVDPDDAIAILLLANEFSWDVPASGALLAGWTALA
PFCGALEWRPHVWVTGNPGSGKSTVLRDYVRGILRGACHVVQSSTSEAGVRSLLGRDAIP
VVFDEADPSDDTNKGQMDNLLGFIRAASSDDSGSIYKGRTDGGCNRFDARAMFCMSSVNV
PISRQSDRDRFCLLSLRRGDPNHDWKGLRLRMAELITPDVGKRIAARTLRLIPTIRANAR
TLAAVLAGRYSQRFGDQCGTLLAGAYSLMSEDVLTPEEAASWVDSMDWSSYAPDDTDTEE
RECIQHLLQTQVQLEGGRRAQIGELVQIAIASPFTPNSVVSIVDRPTAIAILGRHGFKIV
AVDGQTYLAVSNRSKEISSWVRQTRWANAYVSALRKLPGAITPKQGMHFAGVGTQRCTLI
PLTAIDC
Download sequence
Identical sequences Q31QB0
1140.Synpcc7942_0727 gi|81299538|ref|YP_399746.1| WP_011377695.1.45845 WP_011377695.1.5740 WP_011377695.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]