SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299590|ref|YP_399798.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299590|ref|YP_399798.1|
Domain Number 1 Region: 601-701,729-758
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000000000742
Family HD domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299590|ref|YP_399798.1|
Sequence length 820
Comment metal dependent phosphohydrolase [Synechococcus elongatus PCC 7942]
Sequence
MLAERLFTTPSSHVGSCDLASPSMISLPGWIVRPFVRQQPNWSDREPDRFALGPACLVIT
PKRRRSYRRCLALGILGIVAMTALAGQRFYNQPRLDVGMRAAVTITAPDSAQVVDRLSTD
RRRSEARSGTTAVLRINATTNQQLRQTLNAFLAQGEEVREQLGAFPYLPVAQLSEQTQLT
LRQLSPQRWRQLQQALTQPNQPLTDPELQQLLDSLEQVRRRSPQTWPNVLSSIRQAQQRY
TRARDSLDTLQSSARPSPFQPELLDLSNRQWQQLQLTLREALDRILAQGLPQGLPEPVIQ
NTIRSHLGNQLSNSAVLVGQTLLGQVINNQSTLEIDQEKTRFLAELRASAVDDVVVPVRK
GQVIVASGEVIREREFALLDYFGLTRRSPNWPGLIGFGGIVTMGLAVFWLMQRRWQPNLR
VGDRLLLLVLALSVPLGYSTPLHVSTLPAVGLLAGSFYGARLGSTLVVLLTAIAPLGLNL
VPVVDLNSLMASSVAGLVGAVRVGSLRSREEVALLGLGVGMAEGVTFLLCSLINPPAGLF
FASWISLLTTVGIHALRGMAWSVVALGISPYLERIFDLVTPIRLAELANPNRPLLRRLAA
EAPGTFQHTLFVSSLAEAAARALGCNMELVRTGTLYHDVGKLCEPCCFVENQQSGKNQHD
QINDPWQSAAIIQRHVSEGVQLARRAGLPKAVRDFIPEHQGTMLIAYFYHQAKELAQKDP
DRYTVNEQDFRYPGPIPQSRETGIVMLADSCEAALRSLENATMEDALRMVKRIIRARWQD
NQLAASGLSRRDLATIAEVFVQIWQQFHHKRIAYPSTASN
Download sequence
Identical sequences Q31Q58
gi|81299590|ref|YP_399798.1| 1140.Synpcc7942_0779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]