SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299625|ref|YP_399833.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299625|ref|YP_399833.1|
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000237
Family 7-Fe ferredoxin 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299625|ref|YP_399833.1|
Sequence length 74
Comment ferredoxin-like protein [Synechococcus elongatus PCC 7942]
Sequence
MAHTIVTNTCEGVADCVDACPVACIQEGPGRNQKGTTWYWIDFSTCIDCGICLQVCPVEG
AILPEERPELQQTP
Download sequence
Identical sequences A0A0H3K456 Q31Q23
gi|81299625|ref|YP_399833.1| 1140.Synpcc7942_0814 269084.syc0725_c gi|56750734|ref|YP_171435.1| WP_011243037.1.45845 WP_011243037.1.5740 WP_011243037.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]