SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299642|ref|YP_399850.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299642|ref|YP_399850.1|
Domain Number 1 Region: 6-169
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.83e-33
Family HD domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299642|ref|YP_399850.1|
Sequence length 200
Comment hypothetical protein Synpcc7942_0831 [Synechococcus elongatus PCC 7942]
Sequence
MLPTFQPSARIGAAVSLAAQLHADQVRKGTSIPYLAHLLAVASLVMEHGGDEDQTIAALL
HDAIEDTGPESEALIREQFGDRVTAIVWGCTDGVPDAAGQKPDWRDRKQQYLQHLATVAP
DILLVSACDKLHNARSILIDLQNHGLVLFDRFKAGQAGTIWYYQQLATCFQARLPGPLSQ
QLSQTVEAIQQTAKQLESLV
Download sequence
Identical sequences Q31Q06
gi|81299642|ref|YP_399850.1| 1140.Synpcc7942_0831 WP_011377751.1.45845 WP_011377751.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]