SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299846|ref|YP_400054.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299846|ref|YP_400054.1|
Domain Number 1 Region: 81-360
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.3e-67
Family Alanine racemase-like, N-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 469-573
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.00000122
Family Eukaryotic ODC-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81299846|ref|YP_400054.1|
Sequence length 647
Comment arginine decarboxylase [Synechococcus elongatus PCC 7942]
Sequence
MAAEQTAIAPLAVAVESQQWRIEDSEALYRIQGWGEPYFGINAAGHITVSPQGDRGGSLD
LYELVEALRRRGLNLPLLIRFPDILEDRIERLNACFAKAIARYNYAGEYRGVFPVKCNQQ
RHLIESLVNYGRPFQFGLEAGSKPELLIALAHLDTPGALLICNGYKDRDYIETAILGRRL
GKTPILVIEQLEEVDVAIAASQRLGIEPILGVRAKLNARGMGRWGSSAGDRAKFGLTMPE
IVAAVEKLQAANLLHCLQLLHFHIGSQISDISVLKDAIQEAAQIYVQLAALGADMRYLDV
GGGLGVDYDGSKTNFHASKNYNMQTYANDVVATIKDACQAHRLAVPTLTSESGRAIASHQ
SVLVFDVLGSSEVPRAAVEPPQEEDSAIVRTLYEVLEAIALENLQECYHDAFKLKEDAVS
AFRLGYLSLTERAKAERLFWSCCHRIQEFLKQLDRIPEDLEDLERVMASIYYVNLSVFQS
APDTWAIDQLFPIMPIHRLNEEPNQRVTLADLTCDSDGKIDRFIDLLDVKSTLELHSLQP
DQPYVLGMFLGGAYQEIMGNLHNLFGDTNAVHIKLTPKGYSIEHVVKGDTMGEVLGYVQY
DTEQLLERLRQQTEAALQQDQISLDEAQRLLRHYEEGLQRYTYLSLD
Download sequence
Identical sequences Q31PF2
1140.Synpcc7942_1037 NYSGRC-FDAO-ABB57067 gi|81299846|ref|YP_400054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]