SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299921|ref|YP_400129.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299921|ref|YP_400129.1|
Domain Number 1 Region: 75-307
Classification Level Classification E-value
Superfamily Pseudouridine synthase 5.52e-72
Family Pseudouridine synthase RsuA/RluD 0.00000422
Further Details:      
 
Domain Number 2 Region: 14-102
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0000000000692
Family Pseudouridine synthase RsuA N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81299921|ref|YP_400129.1|
Sequence length 313
Comment ribosomal large subunit pseudouridine synthase D [Synechococcus elongatus PCC 7942]
Sequence
MSDRLQLEITEVPSERLDRWLAQQWPHLSRARLQKLIAAGQLRVNGEVCDQKRWQPRLGD
RLELEMPPTEAIALAPEEIPLDILYEDADLLIVNKAVGMVVHPAAGHDTGTLVHALLAHC
GDSLTGIGGEQRPGIVHRLDKDTTGAMVVAKTEAALLSLQDQIRQKTAQREYLGVVFGSP
RQDSGQVEEPIGRHLRDRKRMAVVPIERGGRWALTHWQVRERLGNYALLHYRLATGRTHQ
IRVHSHHMGHPLVGDPLYGNGRSLGVNLQGQALHAWRLSLQHPRTGEVIAVEAPLPAEFQ
RLLRVLRDRSAQS
Download sequence
Identical sequences A0A0H3K653 Q31P77
1140.Synpcc7942_1112 269084.syc0437_d WP_011242749.1.45845 WP_011242749.1.5740 WP_011242749.1.95485 gi|81299921|ref|YP_400129.1| gi|56750446|ref|YP_171147.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]