SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299949|ref|YP_400157.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299949|ref|YP_400157.1|
Domain Number 1 Region: 3-161,242-254,382-445
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.27e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81299949|ref|YP_400157.1|
Sequence length 585
Comment hypothetical protein Synpcc7942_1140 [Synechococcus elongatus PCC 7942]
Sequence
MLETLRTDVLIVGGGTGGTAAALQAARRGAQTILVSEGPWLGGMLTSAGVSAPDGNELRA
LQTGIWGAFLKALRQRQPDGLNHAWVSFFTYDPRVGSQIFADWVRELPNLKWIQGDRPRA
VIGDRDRLRGVEFERVRIEAQVVIDATELGDLLALADVPHRWGWEPQEEWQEPSAPTLAQ
LESDDRYQRYPVQSPTWVVVMADQSQSAPPIPASTSYNPDLFAGAWQTPDNLAFLDYGRL
PGDRFMINWPGPGNDYGEGLQRLIQGDRAHQEWMQEAIAHSQAFAHHIQAHWSDRYGLAR
DQFPQQAIGGGAFALQPYYRESRRVVGSSTITELDLLPLHQGQVAKLPCNASGQVSAIAI
GNYANDHHYPNWDFRLQPKSMRWGGRWTGTAFSLPYDCLLPVQTEGLLVCEKNIAVSHIA
NGATRLQPVVLGLGQAAGMAAALAVEQNCDPRSLSVRDLQEALLTDSEAPQAIVPLYDTP
PEHPDWLTRQRAYLDRPEAYPATGVHGGTAAASLISARAQTVSGQFERLGDQNYQLDDGK
TVWQLVTLDASIDQQFKALSDRLPLAVVGLINPAGHWLIVEAIHP
Download sequence
Identical sequences Q31P49
1140.Synpcc7942_1140 gi|81299949|ref|YP_400157.1| WP_011377880.1.45845 WP_011377880.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]