SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299957|ref|YP_400165.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299957|ref|YP_400165.1|
Domain Number 1 Region: 189-375
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.28e-40
Family HD domain 0.09
Further Details:      
 
Domain Number 2 Region: 10-183
Classification Level Classification E-value
Superfamily GAF domain-like 1.09e-17
Family GAF domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299957|ref|YP_400165.1|
Sequence length 405
Comment metal dependent phosphohydrolase [Synechococcus elongatus PCC 7942]
Sequence
MSPEELQQELQLQSMLIDRSEHALLTLKACNEALVRASGEREFLAEFCRLCVVEAGYAHA
WVTLNSFNPHESLRPFASFGRLQSYVDSLQITWDDQATGQGPTGQAIKTGQIQIADWQAE
QSSLAPWQEIATHYQIKTSISLPLKQGVRTLGALNIYSTQPDAFPPLEQELLAQVAQLLA
YGLSSRRSLAIQDRLLDQTIQAIVQMVELRDPYTQGHENQVAQLAQAIARQLGLDENCIR
GIHVAGLLHDVGKIRVPAEILSKPGCLDPIEYELIKLHPQACYDILKSIQFPWPVAEIAM
QHHERLDGSGYPRQLRGKQILLAARIIAVADVIDAMISHRPYRPGLGLGVAIAEIKNNSG
RLYDPRVVEACLAVLNMSDALETEPTSPPPFQTGDRLAKGGPKGG
Download sequence
Identical sequences A0A0H3K600 Q31P41
WP_011242714.1.45845 WP_011242714.1.5740 WP_011242714.1.95485 gi|56750411|ref|YP_171112.1| 1140.Synpcc7942_1148 269084.syc0402_c gi|81299957|ref|YP_400165.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]