SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299979|ref|YP_400187.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299979|ref|YP_400187.1|
Domain Number 1 Region: 4-159
Classification Level Classification E-value
Superfamily IpsF-like 1.05e-65
Family IpsF-like 0.00000463
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81299979|ref|YP_400187.1|
Sequence length 160
Comment 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Synechococcus elongatus PCC 7942]
Sequence
MSRFRIGNGYDIHRLVEGRPLILGGIQLEHSLGLDGHSDADVLTHAIMDALLGALSLGDI
GHYFPPTDPQWKGADSLKLLAQVNQLIRDRGWTIGNLDSVVVAEQPKLKPHIAAMRDRLA
KVLELEPDQIGIKATTNEKLGPTGREEGICAYAVALLVRD
Download sequence
Identical sequences Q31P19 Q5N549
WP_011242692.1.45845 WP_011242692.1.5740 WP_011242692.1.95485 gi|56750389|ref|YP_171090.1| 1140.Synpcc7942_1170 269084.syc0380_d gi|81299979|ref|YP_400187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]