SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300006|ref|YP_400214.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300006|ref|YP_400214.1|
Domain Number 1 Region: 39-290
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.41e-83
Family Tryptophan biosynthesis enzymes 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300006|ref|YP_400214.1|
Sequence length 295
Comment indole-3-glycerol phosphate synthase [Synechococcus elongatus PCC 7942]
Sequence
MEVRRRPPNPAVHVASLTYQVKVPGSSPSNILEEIVWYKEREVNAWREQLPLQQLQNQVR
GLTQTPRDFLAALRQAPTRPAVIAEVKKASPSKGVLREDFDPVAIAQAYAANGAACISVL
TDEKFFQGGFENLQRVRAAVDVPLLCKDFVIYPYQIYKARLLGADAVLLIAAILSDADLR
YFLKIAHSLGLNALVEVHSLPELERVLALDDLRLVGINNRNLKTFVTDLAVTEHLAAQCR
DRDLLLVSESGLFTGADLDRVTQAGAQAVLIGESLVKQPDPGLALQQLVGDRPSA
Download sequence
Identical sequences Q5N575 Q8KPR4
gi|56750362|ref|YP_171063.1| WP_011242666.1.45845 WP_011242666.1.5740 WP_011242666.1.95485 1140.Synpcc7942_1197 269084.syc0353_d gi|81300006|ref|YP_400214.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]