SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300027|ref|YP_400235.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300027|ref|YP_400235.1|
Domain Number 1 Region: 178-283
Classification Level Classification E-value
Superfamily KaiA/RbsU domain 7.03e-51
Family Circadian clock protein KaiA, C-terminal domain 0.00000189
Further Details:      
 
Domain Number 2 Region: 1-133
Classification Level Classification E-value
Superfamily CheY-like 1.03e-25
Family N-terminal domain of the circadian clock protein KaiA 0.000000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300027|ref|YP_400235.1|
Sequence length 284
Comment circadian clock protein KaiA [Synechococcus elongatus PCC 7942]
Sequence
MLSQIAICIWVESTAILQDCQRALSADRYQLQVCESGEMLLEYAQTHRDQIDCLILVAAN
PSFRAVVQQLCFEGVVVPAIVVGDRDSEDPDEPAKEQLYHSAELHLGIHQLEQLPYQVDA
ALAEFLRLAPVETMADHIMLMGANHDPELSSQQRDLAQRLQERLGYLGVYYKRDPDRFLR
NLPAYESQKLHQAMQTSYREIVLSYFSPNSNLNQSIDNFVNMAFFADVPVTKVVEIHMEL
MDEFAKKLRVEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPRET
Download sequence
Identical sequences Q79PF6
WP_011377921.1.45845 WP_011377921.1.95485 5n8y_M 5n8y_N 5n8y_O 5n8y_P 5n8y_Q 5n8y_R 5n8y_S 5n8y_T 5n8y_U 5n8y_V 5n8y_W 5n8y_X 1140.Synpcc7942_1218 gi|81300027|ref|YP_400235.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]