SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300101|ref|YP_400309.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300101|ref|YP_400309.1|
Domain Number 1 Region: 119-430
Classification Level Classification E-value
Superfamily DNA primase core 2.49e-99
Family DNA primase DnaG catalytic core 0.0000124
Further Details:      
 
Domain Number 2 Region: 5-101
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 5.78e-34
Family DNA primase zinc finger 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300101|ref|YP_400309.1|
Sequence length 694
Comment DNA primase [Synechococcus elongatus PCC 7942]
Sequence
MDTPRLHPETIAAVKERADIVDIVSEQVVLKKRGKDFVGLCPFHDDKSPSFTVSPAKQFY
YCFSCGAGGNPIKFLMELGKQSFSEVVLDLAKRYQVPVRTLEVQQHQELQRQLSRRERLY
EVLAVATQFYEQSLRRPEGAAALDYLRRSRQLQESTIQKFQLGYAPAQWASLATHLIEQK
RFPADLVEEAGLVVARRNGQGYYDRFRDRLMIPIHDLQGRVVGFGGRTLTGEEPKYLNSP
ETTLFEKGKLLFGLDKARAAIAKQDQAVVVEGYFDVIALHAAGIDHAVASLGTALSRQQV
KLLSRYSESNQIVLNFDADRAGAKAAERAIGEVEDLAYQGQVQLRVLNLPGGKDADEYLQ
RHSVADYRELLARSPLWLDWQIDQLLRDRNLDQADQFQAVVQAIVQLLGKLPNTPLRTHY
VHQVAERLSQGEARTAVQLASDLRAQVRGQRWHGQASRWEKPGDVSIREQAEAQILKVYL
HCPRLRLAVRKTLHDREIQGFSLQPHRLLWQAIAEIEEAHLGFAAMYQVERGEGNGDDLA
AIDLVPILRDRLDQLTGVSLGGFLELSENDHADLTHPLPLLRGAVALVERLRCEKRCRHL
LDSWARQSIHTFEHCIEQLLQAGIGEDVDAEAQITALHEQLNQEALHFQKLYYNERRYLQ
QLDQERCLNPQAFLGMTEHDATAIAPTTPQPISA
Download sequence
Identical sequences P74893
gi|81300101|ref|YP_400309.1| 1140.Synpcc7942_1292 WP_011377965.1.45845 WP_011377965.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]