SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300186|ref|YP_400394.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300186|ref|YP_400394.1|
Domain Number 1 Region: 55-227
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.09e-73
Family HD domain 0.00000135
Further Details:      
 
Domain Number 2 Region: 230-405
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.11e-62
Family RelA/SpoT domain 0.00000866
Further Details:      
 
Domain Number 3 Region: 415-487
Classification Level Classification E-value
Superfamily TGS-like 8.07e-22
Family G domain-linked domain 0.068
Further Details:      
 
Domain Number 4 Region: 693-771
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000219
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300186|ref|YP_400394.1|
Sequence length 779
Comment metal dependent phosphohydrolase [Synechococcus elongatus PCC 7942]
Sequence
MPSAGLPAVPFSADAMNVAAPAANFPSTFAVELPAWLEQSLSHEEQQSEESPDGSDHCLI
ARAFRFAYSLHEGQYRASGEPYIAHPVAVAGLLRDLGGSAAVICAGFLHDVVEDTEVTPE
EIEERFGAEVRQLVEGVTKLSKFNFSSKTEQQAENFRRMFLAMAQDIRVILVKLADRLHN
MRTLEHLASTKQKRIAKETMDIFAPLANRLGIGRVKWELEDLSFKYLDAEQYRSIQGHVA
EKRADREARLEQSVQILRDRLSQIGIEPVDVSGRPKHLYSIYRKMQMQQKEFHEIFDVAA
LRIIVNSNDECYRALAVVHDAFRPIPGRFKDYIGLPKPNRYQSLHTTVIGLSGRPLEIQI
RTLEMHRIAEYGIAAHWKYKESGGSAGKFSTEDEKFTWLRQLLEWQHDLKDAKEYLENIK
DNLFDEDVYVFTPGGDVIALAQRSTPVDFAYRIHTEVGNRCAGAKVNGRIVPLETRLNNG
DIVEILTQKNARPSLDWLNFVVTSAAKNRIRQWYKRSHRDENIARGREMLEKELGKPGFE
ALLKSEPMQKVAERCNYPSPDDLLAAIGYGEMTITLVVNRIRDAVRSQQPALLEGTDTAL
SDADLAATLSQATQRHDAQRPVSRSPIIGVEGLVYRLAGCCNPLPGESILAVVSRGNHGI
AVHRQSCPNVEGIAGDRLIPVCWNPDEVKAPRPQTYPVNVQITVLDRVGVLRDILTRLSD
NNINVRNAQVKTTPGKPAIIDLCIDLASADQLGRTFSQIRQMSDVLHIRRLSSGSDDEL
Download sequence
Identical sequences Q31NG2
1140.Synpcc7942_1377 gi|81300186|ref|YP_400394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]