SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300192|ref|YP_400400.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300192|ref|YP_400400.1|
Domain Number 1 Region: 7-169
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-62
Family Inorganic pyrophosphatase 0.0000063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300192|ref|YP_400400.1|
Sequence length 170
Comment inorganic diphosphatase [Synechococcus elongatus PCC 7942]
Sequence
MDLSRIPAQPKPGLVNVLIEIPGGSKNKYEFDKDLNAFALDRVLYSSVQYPYDYGFIPNT
LADDGDPLDGMVILDQPTFPGCVIAARPIGMLEMIDGGDRDEKLLCVPAKDPRYAEVKTL
SDLAPHRLEEIAEFFRSYKNLEKKVTEILGWKGPETVQALVDECIKAYNA
Download sequence
Identical sequences A0A0H3K2I9 Q31NF6
gi|56750181|ref|YP_170882.1| 1140.Synpcc7942_1383 269084.syc0172_d WP_011242486.1.45845 WP_011242486.1.5740 WP_011242486.1.95485 gi|81300192|ref|YP_400400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]