SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300225|ref|YP_400433.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300225|ref|YP_400433.1|
Domain Number 1 Region: 2-586
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 7.06e-187
Family Prokaryotic type I DNA topoisomerase 0.00000000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300225|ref|YP_400433.1|
Sequence length 883
Comment DNA topoisomerase I [Synechococcus elongatus PCC 7942]
Sequence
MPKLVIVESPTKARTIRNYLPKDYRVEASMGHVRDLPQSASDIPTELKGEKWSNLGVDVE
NNFAPLYIVPKDKKKIVKTLKDALKDADELILATDEDREGESISWHLLQLLQPRVPTKRM
VFHEITQEAIQAALKNCRDVDQRLVHAQETRRILDRLVGYTLSPLLWKKIAWGLSAGRVQ
SVAVRLLVQRERARRAFRQGSYWDLKAQLTVEAGQFEAKLWTLAGQRLATGNDFDESTGQ
IIAGRQVCLLDQQEAEALRDRLQTQPWQVKSLEEKPTTRKPAPPFTTSTLQQESNRKLRL
SARETMRVAQSLYERGFITYMRTDSVHLSQQAIEAARSCVEQMYGKNYLSPQPRQFTTKS
KNAQEAHEAIRPAGNTFRLPQETGLSGAEFALYDLIWKRTIASQMAEARQTMLSVLLEVD
NAEFRASGKRIDFPGFFRAYVEGSDDPDAALEDREILLPALKVGDRPTCQELAAIGHETQ
PPARYTEASLVKMLENEGIGRPSTYASIIGTIVDRGYAQLVSNTLTPTFTAFAVTALLEQ
HFPDLVDTSFSARMEQSLDDISNGEVDWLPYLSQFYRGDRGLEEQVKLRESEIDPAAART
VALEGLPAKVRIGRFGAYLEAEADGEPIKANLPKELTPADLDVQRVETLLRQKTEGPDQL
GTHPETDEPIYLLTGAYGPYVQLGAATEEKPKPKRASLPKGMSLETISLEQAVGLLSLPR
TLGEHPETGRRIQAGLGRFGPYVVCDLGGGEKDYRSLKADDDVLTIDLDRALELLAQPKK
SRGRGKEPIREVGLHPDDQAPIQIFEGPYGLYLKHGKVNASLPEDEKPETISLETAVAAL
AAKAGQAKAKGGRRSTGTPKSGETKARTTKTTKKTTTRRTTSR
Download sequence
Identical sequences A0A0H3K2F5 P34185
1140.Synpcc7942_1416 269084.syc0139_c gi|56750148|ref|YP_170849.1| gi|81300225|ref|YP_400433.1| WP_011242453.1.45845 WP_011242453.1.5740 WP_011242453.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]