SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300244|ref|YP_400452.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300244|ref|YP_400452.1|
Domain Number 1 Region: 14-196
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.8e-36
Family Pyruvate oxidase and decarboxylase Pyr module 0.0034
Further Details:      
 
Domain Number 2 Region: 388-570
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.18e-24
Family Pyruvate oxidase and decarboxylase PP module 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|81300244|ref|YP_400452.1|
Domain Number - Region: 301-383
Classification Level Classification E-value
Superfamily Citrate synthase 0.0283
Family Citrate synthase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300244|ref|YP_400452.1|
Sequence length 582
Comment 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [Synechococcus elongatus PCC 7942]
Sequence
MGQAAAITMPIDPRNLNTLWSSVLAESFVRLGLQTVVICPGSRSAPLAIAFAEHPEIDAI
PILDERSAGFFALGRAKASHRPVALICSSGTAGANFYPAVIEAKESGVPLLVITADRPPE
LRQCHAGQAIDQLRLFGSYALWEAELALPVLDLGLLRYLRQTAQQAWQQALRGGPVHLNQ
PLREPLAPIADPATQTWLAQQWPGENFFAELLTAVPTPQIQQPLPPLPSQGLITVGPIAP
EDPAAFVQAIAQLSAHLGWPVLSDAVTPLRQFADHCPRLISSYDLILRQPHWRASLQPEA
VLQIGELPTSKELRLWLTEQTCPRWIVSPRPENFDPLHGSSHHLPVTVEAIAIPATIAPA
SDYSRQWQQAETAVQAAIAQHLAQVPDLTEPGIARLLSQHLPAQTPIFVANSTPIRDLEW
FWLANDQRRSLYCSRGANGIDGTLSTAIGIAHQNRPSVLITGDLSLLHDSNGFLQRSQLQ
GHLTVVLIDNSGGGIFELLPIRDCGPSFEPFVATPQTVDFAALCQAYGVDYQAIATEAEL
IKAIQTLPTSGIRVLHLFTDRRQNAAWRRALFAELAAIPSQS
Download sequence
Identical sequences Q31NA4 Q5N5V7
WP_011242435.1.45845 WP_011242435.1.5740 WP_011242435.1.95485 gi|56750130|ref|YP_170831.1| 1140.Synpcc7942_1435 269084.syc0121_d gi|81300244|ref|YP_400452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]