SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300390|ref|YP_400598.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300390|ref|YP_400598.1|
Domain Number 1 Region: 3-142,216-347
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.86e-60
Family Carboxypeptidase T 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300390|ref|YP_400598.1|
Sequence length 559
Comment peptidase M14, carboxypeptidase A [Synechococcus elongatus PCC 7942]
Sequence
MLNFACDRFYRYDELTQLLQDCAAAYPQLLKLESLGKSHEGRELWLLRITDYSKGDDTEK
PALWIDGNIHATELAASSACLHFLQVLLRGFEQGNPVVQRCLQRCTIYLCPRQNPDGAEL
ALADQPQFLRSSTRPYPLRDRDSSGLQEADIDGDGRILLMRIPDPHGAWKVHPQEPRLLV
RRDPVETGGQYYRVLPEGLIQDYDGDLIPLQPRQQGLDLNRNYPIDWRPEHEQLGAGPFP
ASEPEVQAVVKFLSDRTNLFAAISFHTFSGVLLRPYSHKPDDTFPVADLRAYEVIGKAGE
EQTGYPAIGVYDNFRYHPKEITTGVFDDWAYDHLGLFAWTVEIWSPQKAAGIEKYDWIDW
FREHPVEDDLKFLEWNDRELEGKGFIDWYPFEHPQLGPLELGGWDDLHTWRNPPQKFLQA
ELDRFPQWLLWQLQIAPQLEVIRAEVQALGDRLYKVKFVLQNSGWLPTYISQKALERHLV
DPLVAELQLPEGIELCQGKARQELGQLEGRSQKGVMPEADPTSDRAKAEWIIRGDRGQVI
TIEARHPRAGKLQQQLTLN
Download sequence
Identical sequences A0A0H3JYU7 Q8KPU3
gi|81300390|ref|YP_400598.1| WP_011242351.1.45845 WP_011242351.1.5740 WP_011242351.1.95485 1140.Synpcc7942_1581 269084.syc0038_d gi|56750047|ref|YP_170748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]