SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300638|ref|YP_400846.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300638|ref|YP_400846.1|
Domain Number 1 Region: 1-237
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.16e-75
Family Histidine biosynthesis enzymes 0.00000694
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300638|ref|YP_400846.1|
Sequence length 256
Comment 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase [Synechococcus elongatus PCC 7942]
Sequence
MDVIPAIDLLGGQCVRLFQGDYDQAEVYGKDPVGMALRWAEAGAQRLHLVDLDGAKEGSP
VNAEAIATIAQRLSIPVQVGGGLRDRDTVARLLDSGVERAILGTVAVERPALVEALAGEF
PGQIAVGIDARSGKVATRGWLEDSGLTAVALAQQMADLGACALICTDIGRDGTLQGPNLE
ELRAIAAAVSIPVIASGGVGSLTDLLSLLPLEAQGVSGVIVGKALYTGAVDLQEALRAIG
SGRWQDVAVDDSSRLA
Download sequence
Identical sequences Q5MZR5 Q8GJM0
WP_011244575.1.45845 WP_011244575.1.5740 WP_011244575.1.95485 1140.Synpcc7942_1829 269084.syc2265_c gi|56752274|ref|YP_172975.1| gi|81300638|ref|YP_400846.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]