SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300690|ref|YP_400898.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300690|ref|YP_400898.1|
Domain Number 1 Region: 7-256,348-392
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.78e-56
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000262
Further Details:      
 
Domain Number 2 Region: 230-345
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 7.92e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000431
Further Details:      
 
Domain Number 3 Region: 424-544
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.44e-27
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300690|ref|YP_400898.1|
Sequence length 550
Comment L-aspartate oxidase [Synechococcus elongatus PCC 7942]
Sequence
MSDSAAPAAGSTAYDVIIVGAGAAGLYTGLCLPSHYRVAILSKDLPQRSASDWAQGGLAA
VTAPDDSADLHYADTLKAGADLCEPAAVRLLVESAPRCVASLLELGVAFDRTNDHLALTL
EAAHSRHRVLHAADTTGRAIVTTLLEQVLQRPNLEILAQSLAVDLWRDREGHCCGLLLLQ
GQQLRWLAARAVILACGGGGQVFSQTTNPALSTGDGVALAGRAGAKLRDLEFFQFHPTAL
VWPGAPRFLISEAVRGEGAHVVDAQGDRFLFRYDDRGELAPRDIVSRAIYRHLLETGTEQ
VWLDLRPIPAATVEHRFPNILQKCRRWGLDPLQQPLPIAPAAHYWMGGVYTNLNGATTCP
GLYAVGETACTGVHGANRLASNSLLECLVFGRQFQNLQLPAAIAASSRLDSVHPLSVMGD
RDRWKKQRQALQDLVWKAAGICRDADRLQAALAQVEVWQADLDAEPLSQAIAAIPLGQTQ
QLDGLDAEALRDWGELRNLLAIAQLILKSADFRTESRGGHYRSDYPKSNPGWRVHTDVQS
GRWGTTAIGP
Download sequence
Identical sequences Q31M08
1140.Synpcc7942_1881 gi|81300690|ref|YP_400898.1| WP_011378229.1.45845 WP_011378229.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]