SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300715|ref|YP_400923.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300715|ref|YP_400923.1|
Domain Number 1 Region: 116-210
Classification Level Classification E-value
Superfamily FKBP-like 1.77e-18
Family FKBP immunophilin/proline isomerase 0.0042
Further Details:      
 
Domain Number 2 Region: 13-109
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 0.000000349
Family Porin chaperone SurA, peptide-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300715|ref|YP_400923.1|
Sequence length 246
Comment hypothetical protein Synpcc7942_1906 [Synechococcus elongatus PCC 7942]
Sequence
MTLTSSQKPFRLLVGDREVQESDLAALLQKHQLLPELVKRMRFAQVIEGIEVQPDVLEQE
CQAWCKQNGIAPQQLPQLLAQQQISLEQWMSSVENRLRLRLFQEREFSHRAENRFLKRKS
QLDLVTYSLLRHSDGHLIQELYQQLLHGEATFEDLATQFSQGHEAKTAGKLGPVPLSQPH
PALAEVLRTAQPGQILPPRNLESYWLIIRLDQLQPVAFNETIRRQMLQELFDEWLGAEVQ
QTLNTL
Download sequence
Identical sequences A0A0H3K5B3 Q31LY3
WP_011244499.1.45845 WP_011244499.1.5740 WP_011244499.1.95485 gi|56752198|ref|YP_172899.1| gi|81300715|ref|YP_400923.1| SnR125 1140.Synpcc7942_1906 269084.syc2189_d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]