SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300779|ref|YP_400987.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300779|ref|YP_400987.1|
Domain Number 1 Region: 38-142
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.05e-18
Family Bacterial dinuclear zinc exopeptidases 0.0023
Further Details:      
 
Domain Number 2 Region: 2-51
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00000262
Family Bacterial exopeptidase dimerisation domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300779|ref|YP_400987.1|
Sequence length 148
Comment N-acyl-L-amino acid amidohydrolase, partial [Synechococcus elongatus PCC 7942]
Sequence
MIADRVRLLGTVRSLHPETHAGLPDWIESIIASICKTYDAHYEFHYRRGVPSVQNDETLT
RLVEAAAIEAWGQTAVERIEEPSLGAEDFSVYLEKIPGMMFRLGVGYPDRQNPPLHHPQF
EIDERALIVGVITLAYSIWRYWQPAVKG
Download sequence
Identical sequences Q31LR9
1140.Synpcc7942_1970 gi|81300779|ref|YP_400987.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]