SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300780|ref|YP_400988.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300780|ref|YP_400988.1|
Domain Number 1 Region: 9-215
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.26e-64
Family Bacterial dinuclear zinc exopeptidases 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300780|ref|YP_400988.1|
Sequence length 252
Comment peptidase M20D, amidohydrolase, partial [Synechococcus elongatus PCC 7942]
Sequence
MLVCPVLDRIREVATRLEPRLLEIRRHLHAHPELSGHEHQTAAYVAGVLSSCGLQVREGV
GRTGVVGDLPGTGRDRRCLALRTDMDALPIEEQTGLPFASRQQGIMHACGHDLHTTLGLG
AAMVLSELGEPLPGDVRWLFQPAEEIAQGARWMVAAEALEGVDAILGVHVFPSIPAGVVG
IRYGALTAAADDLEIVIQGESGHGARPHEAKDAIWIAAQIITMLQQAISRTQNPLRPVVL
TIGQIQGGELLM
Download sequence
Identical sequences Q31LR8
gi|81300780|ref|YP_400988.1| 1140.Synpcc7942_1971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]