SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300823|ref|YP_401031.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300823|ref|YP_401031.1|
Domain Number 1 Region: 33-174
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 4.32e-23
Family DPP6 N-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300823|ref|YP_401031.1|
Sequence length 197
Comment hypothetical protein Synpcc7942_2014 [Synechococcus elongatus PCC 7942]
Sequence
MPRRRRWSDRRRWLGLLAGVAVLLGIGAALLSWFLRPGAVVVTPNLNSRYSESQPALSGD
GRYLAYVAERDGHRTIYLYDLQRRQLQPLPGFADRDAIAESPSLSWTGRYIAYVGSDRGR
PEIQVYDRATQRREVLTQGWRGWVRQPSISPDGRLVAFESSRRGQWDIELFDRGELTELD
RPEGSRESSAPIASPQP
Download sequence
Identical sequences A0A0H3K520 Q31LM5
gi|81300823|ref|YP_401031.1| 1140.Synpcc7942_2014 269084.syc2081_d gi|56752090|ref|YP_172791.1| WP_011244391.1.45845 WP_011244391.1.5740 WP_011244391.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]