SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300894|ref|YP_401102.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300894|ref|YP_401102.1|
Domain Number 1 Region: 1-263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.33e-18
Family Nitrogenase iron protein-like 0.043
Further Details:      
 
Weak hits

Sequence:  gi|81300894|ref|YP_401102.1|
Domain Number - Region: 297-343
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.0889
Family HSP20 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300894|ref|YP_401102.1|
Sequence length 358
Comment anion transporting ATPase [Synechococcus elongatus PCC 7942]
Sequence
MTQILSFLGKGGSGRTTAAIALARQSAASGARTLVLSLGSDPSPDMLLDKDLVATPTVIS
PNLEAVRIPSTVAIGKGWEELQALEGQYLKTPFLRNIYSSELALLPGFEPLLLLTELRRW
LEQGYDRICLDGLSSPELLRLWGVPESLDWYLRRFRGAIADSEFGRNLGPFLPALSAAVF
SVGLSLDDWGPAARLLETSLEQGRSLLADPRKAMAILTTRSDRVSQAVALQWWGAAQPIG
LRVGAVLASESSGLDDLKRDFAPLPVFSLSSAASDSVLPSFDVLNHAPEPLSIDLQARQI
RLFLPGLAKEAVKLSQSGPEITIEAGDQRRNLRLPVALQGRAVTSARFQEQSLILSFQ
Download sequence
Identical sequences A0A0H3K499 Q31LF4
gi|81300894|ref|YP_401102.1| gi|56752017|ref|YP_172718.1| 1140.Synpcc7942_2085 269084.syc2008_d WP_011244318.1.45845 WP_011244318.1.5740 WP_011244318.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]