SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300943|ref|YP_401151.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300943|ref|YP_401151.1|
Domain Number 1 Region: 172-348
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.14e-55
Family N-acetylmuramoyl-L-alanine amidase-like 0.000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300943|ref|YP_401151.1|
Sequence length 349
Comment cell wall hydrolase/autolysin [Synechococcus elongatus PCC 7942]
Sequence
MSKRWLARSAAVAIACLPALISLEAISTQPAIAQAAVNNLRSIDADAEGQLIFRTDAPPR
FEWTPDLGGNYQLTLFDTQLPLNFRTLPPPLSLARFEINRQGNNIVIRLRTRPGSRLEPP
VMTAAGLLGLMLPKASLPALTTAPPRLTPLVPNLNPIPQPSVVGLPPLTRPAVIVIDPGH
GGRDPGAIGIGGIRETDIVLDISTQVTRLLQAQGAQVVMTRQDDREVDLAPRVAIAQRAR
ATVFVSIHANALSMSRPDVNGIETYFFSAASRPLAQAIQDRMMQFFPDMRNRGVKQARFY
VIRQTTMPSSLVEVGFVTGAEDAPRLADPTFRAQMSQAIAAGILDFLNR
Download sequence
Identical sequences A0A0H3K4S0 Q31LA5
gi|81300943|ref|YP_401151.1| WP_011244268.1.45845 WP_011244268.1.5740 WP_011244268.1.95485 gi|56751967|ref|YP_172668.1| 1140.Synpcc7942_2134 269084.syc1958_d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]