SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81301002|ref|YP_401210.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301002|ref|YP_401210.1|
Domain Number 1 Region: 24-216
Classification Level Classification E-value
Superfamily GAF domain-like 3.93e-29
Family GAF domain 0.0011
Further Details:      
 
Domain Number 2 Region: 428-542
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000192
Family HD domain 0.043
Further Details:      
 
Domain Number 3 Region: 222-305
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000000371
Family HD domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81301002|ref|YP_401210.1|
Sequence length 560
Comment metal dependent phosphohydrolase [Synechococcus elongatus PCC 7942]
Sequence
MAAADHVEPAIAPDRSEAKATATLLERLLAIGTALSACRDPDQLLSLILQSSRDLTCSDG
GSLYLVDRSDPQQPWLRFQIFQSDSLPSSLEAPPPLPLDRHSLAGYVAATGETLNLADVY
ALDGQQPFQFNASFDQRLNYRTCSMLVLPMCDQTGSVIGVIQLVNRKRRADLKLTAAIAS
EETQPYSAAEEALLRSLAGQAAIAIERTLLQRSIENLFEGFICASIKIIESRDPCTMGHS
ERVAQLSVRLAEQVHAVDHGALAAYQFSNAQLQELHYASLLHDFGKVGVPEEILNKSHKL
HPTEQQGLNYRLQLLQQQLQLEQARRWLAPTLTEAMQRAGLGHPLDCIWCRQFGNLADLE
VTIARLQQARSLLQDLNQPQILATPAYRDRLAEVEAELAWLASLQVMDWDGQMRSLLAPA
EVEKLLIPKGSLTQQERLAIESHVQHTFAFLQEIPWTGPLAQVPHIAHAHHERLDGSGYP
LGLEQAQIPMQAQIMAVADVYDALTASDRPYKRRVPIEKALQILEWEARDRKLNDQLVQL
FRQQQIFQILGHQLQSEDSV
Download sequence
Identical sequences Q31L46
WP_011378358.1.45845 WP_011378358.1.95485 1140.Synpcc7942_2193 gi|81301002|ref|YP_401210.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]