SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81301013|ref|YP_401221.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301013|ref|YP_401221.1|
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily L28p-like 1.77e-25
Family Ribosomal protein L31p 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81301013|ref|YP_401221.1|
Sequence length 77
Comment 50S ribosomal protein L31 [Synechococcus elongatus PCC 7942]
Sequence
MPKADIHPQWYPEAKVYCNGEEVMTVGSTQPELHVDVWSGNHPFYTGTQKIIDTEGRVER
FLRKYGMLEGDQAKSEA
Download sequence
Identical sequences Q31L35 Q5N0T7
gi|56751902|ref|YP_172603.1| WP_011244203.1.45845 WP_011244203.1.5740 WP_011244203.1.95485 1140.Synpcc7942_2204 269084.syc1893_d gi|81301013|ref|YP_401221.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]