SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81301037|ref|YP_401245.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301037|ref|YP_401245.1|
Domain Number 1 Region: 3-84
Classification Level Classification E-value
Superfamily Ribosomal protein S19 1.12e-36
Family Ribosomal protein S19 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81301037|ref|YP_401245.1|
Sequence length 91
Comment 30S ribosomal protein S19 [Synechococcus elongatus PCC 7942]
Sequence
MARSLKKGPFVADHLLRKVEKLNAKGDKQVIKTWSRASTILPQMIGHTIAVHNGRQHVPV
YVTEQMVGHKLGEFAPTRTFRGHTKDKKAGR
Download sequence
Identical sequences O24693 Q31L11
gi|81301037|ref|YP_401245.1| WP_011244179.1.45845 WP_011244179.1.5740 WP_011244179.1.95485 1140.Synpcc7942_2228 269084.syc1869_d gi|56751878|ref|YP_172579.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]