SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81301138|ref|YP_401346.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301138|ref|YP_401346.1|
Domain Number 1 Region: 4-408
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.09e-101
Family HD domain 0.000000868
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81301138|ref|YP_401346.1|
Sequence length 424
Comment metal dependent phosphohydrolase [Synechococcus elongatus PCC 7942]
Sequence
MPSRRQRIYHDPLHGAIALQFEDPLEATLIRLIDTPPFQRLRRICQLGPASLTFHGAEAS
RFTHSLGVMQVARRAFAPIAADWPELAVHRPALLCAALLHDLGHTAFSHTGEEIFHCQHE
QWTARLITEDSPIRRVLADYDPALPEQVLAVYRKQYQPLLISRLITSQLDCDRLDYLLRD
SYFTGASYGRLDLDRILSALRFDSESGELAVAEKGLAAIEHYLVVRSFMYSQVYNHPKNI
VAGWMLVRIFERARQLWQEQPRSLFVDPLLQPWFEQPVTDLSLEEYLAVDDIVCLYHLQR
WQDSADPLLADLCRRYRDRDLLKALNLRNLPAEQQQTLLEHSQQLIRNQGQDPTGYTGLC
QTQSRGYTLYQSGIRLATDQGLLEISQRSPLIRALLEPPSQAWLIYPRVIEQPLKQQWQL
VRGS
Download sequence
Identical sequences Q31KR0
gi|81301138|ref|YP_401346.1| 1140.Synpcc7942_2329 WP_011378407.1.45845 WP_011378407.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]