SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81301193|ref|YP_401401.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301193|ref|YP_401401.1|
Domain Number 1 Region: 794-1187
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.71e-121
Family PFOR PP module 0.0000000336
Further Details:      
 
Domain Number 2 Region: 8-260
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.42e-78
Family PFOR Pyr module 0.0000000766
Further Details:      
 
Domain Number 3 Region: 418-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.5e-72
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000108
Further Details:      
 
Domain Number 4 Region: 262-415
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.86e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000149
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.85e-21
Family Ferredoxin domains from multidomain proteins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81301193|ref|YP_401401.1|
Sequence length 1196
Comment pyruvate:ferredoxin (flavodoxin) oxidoreductase [Synechococcus elongatus PCC 7942]
Sequence
MASSPVYATLDGNEAVARVAYRLSEVIAIYPITPASPMGEWADAWAATHRPNLWGDVPSI
VEMQSEAGAAGAVHGALQVGALTTTFTASQGLLLMIPNLYKIAGELTPMALHIAARSLAA
QGLSIFGDHSDVMAVRGTGCALLCSASVQEAQDFAAIALRASLQSRIPFLHFFDGFRTSH
EIQKIALLPDEVLQQYIPAEAIREHRHRALSPDHPVIRGTAQNPDVYFQARETVNRYYNA
APALVQAAMDEFAQLTGRAYELVDYVGAPDAERAIVVMGSGAEVAEQTVLALQAQGEKVG
VLKLRLYRPFPAAELRQALPATVKAIAVLDRCKEPGASGEPLYLDVVEALSRLEQPPRVI
GGRYGLSSKEFTPAMTKAIFDHLSQTRLQHPFTIGIEDDVTHLSLPWDPSWSIEAADTVR
AIFYGLGSDGTVGANKNSIKIIGEDTDNWAQGYFVYDSKKSGSVTVSHLRFGPRAIAAPY
LIRQANFVACHQWQFLHSFDLIDSAAPHATLLINSPYSPEETWQQLPEKVQQGILDKQLQ
PWVINADALAAEQGLGRHINTVMQVAFFALSGVLPQDTAIAAYRRAVQKTYGKKGQAVVD
ANLAIIEPTLAALKPLPIGIPVAVGVTETPAIASAPPFVRDVLGAMLARKGDQLPVSALP
VDGTYPSGTSCYEKRNISDTVPVWEPDLCVQCGKCLLVCPHGVIRAKVYESEVLEAAPET
FKHAPARDATWSDRPFTIQVSTEDCTGCQLCVEVCPARDRQQPRRKALNMAAQAPLREAE
RHNWDFFLSLPEVDRSALNLHKIGQQQLQQPLFEFSGACAGCGETPYLKLMTQLFGDRLL
VANATGCSSIYGGNLPTTPWTHNAEGRGPAWSNSLFEDNAEFGLGFRVALDQQEAMAQQL
LSHLAAIAGSPLSPELVQQTLNADQSSEAGIFEQRDRVQQLKQQVQDWLSQEPDASVSDR
LNRWLDLADTLVRKSVWLVGGDGWAYDIGFGGLDHVLASGRNVNILVLDTEVYSNTGGQM
SKSTPRAAVAKFAAGGKPSAKKDLGLIAMTYGSAYVASVALGARDEHTIRTFIEAESYPG
PSLIIAYSHCIAHGIDMTKGLDAQKRAVDSGRWLLYRYDPRRRDRGDNTLQLDSRSPHLP
LSQALYSENRFQMLRLSQPEAAQQLLDQAQADVDQRWQFYQALAKPTPKPTAGGPQ
Download sequence
Identical sequences Q31KK5
1140.Synpcc7942_2384 gi|81301193|ref|YP_401401.1| WP_011378437.1.45845 WP_011378437.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]