SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81301220|ref|YP_401428.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301220|ref|YP_401428.1|
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-24
Family BPHL domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81301220|ref|YP_401428.1|
Sequence length 94
Comment hypothetical protein Synpcc7942_2411 [Synechococcus elongatus PCC 7942]
Sequence
MIYCAYKGARDLLFFTTRRILLIDKQGITGKKQEYLSIPISRIQAFSYETAGTIDLDSEI
KIFISVLGALKIRIIRPTSNMDPAITALNMMLLS
Download sequence
Identical sequences Q31KH8
gi|81301220|ref|YP_401428.1| 1140.Synpcc7942_2411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]