SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81301236|ref|YP_401444.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301236|ref|YP_401444.1|
Domain Number 1 Region: 2-155
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.05e-41
Family Multidomain sulfurtransferase (rhodanese) 0.00083
Further Details:      
 
Domain Number 2 Region: 166-279
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.44e-24
Family Multidomain sulfurtransferase (rhodanese) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81301236|ref|YP_401444.1|
Sequence length 280
Comment 3-mercaptopyruvate sulfurtransferase [Synechococcus elongatus PCC 7942]
Sequence
MSSPLVSAEWLQAHLHDNDLCLVDCRFNLMQPQQGRDQYQQGHLPGAVYLDLEQDLSAPK
GDRGGRHPLPDIEALAARLGAIGISSDPATLVVAYDASFSAFASRLWWLLRYLGHERVAV
LDGGLAAWQAIGGELVTDIPAIAPAKFQPHPQTGWVVDAVGLKVAQARGQVLIDSREADR
YRGDREPIDPVAGHIPGAQLAVWKEALDEKGYWRLPSEQQQRWQHLSTAVQPIIYCGSGV
TACVNLLSWELAGRSPAQLYAGSWSDWCSDPENAIATGEE
Download sequence
Identical sequences Q31KG2
1140.Synpcc7942_2427 gi|81301236|ref|YP_401444.1| WP_011378458.1.45845 WP_011378458.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]