SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81301249|ref|YP_401457.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301249|ref|YP_401457.1|
Domain Number 1 Region: 302-496
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.23e-47
Family Ribonuclease PH domain 1-like 0.00000625
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-44
Family Ribonuclease PH domain 1-like 0.0000198
Further Details:      
 
Domain Number 3 Region: 459-557
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.5e-28
Family Ribonuclease PH domain 2-like 0.0000798
Further Details:      
 
Domain Number 4 Region: 143-227
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.83e-26
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 5 Region: 564-649
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.45e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 6 Region: 622-702
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.21e-19
Family Cold shock DNA-binding domain-like 0.00049
Further Details:      
 
Domain Number 7 Region: 237-329
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000000251
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81301249|ref|YP_401457.1|
Sequence length 716
Comment polynucleotide phosphorylase [Synechococcus elongatus PCC 7942]
Sequence
MPQLSKSLSFDGRDIRLELGLFAPQAGGSVLISSGDTAVLVAATRSTAREGIDFLPLTVD
YEERMYAAGRIPGGFLRREGRPPERATLTSRLIDRPLRPLFPSWLRDDLQVVATTLSMDE
TVPPDVLAVTGASIATLVAKIPFYGPMAAVRVGLVGDDFIINPTYREIEKGDLDLVVAGT
PAGVIMVEAGANQLPEADVIEAIDFGYEAVQELIKAQQSLLAELGIEQILPEAPNADNTL
ENFVRDRASSGVQQVLQHFSFTKSERDAALDEVKASVVEAIAALPEEDPVRSVTAAEPKA
LGNTFKALTKTLMRQQILRDGVRVDGRKLDQVRPISSQVGLLPPRVHGSGLFQRGLTQVL
SIATLGTPGDAQELDDLHPDTQKRYLHHYNMPPYSVGETRPMRSPGRREIGHGALAERAL
LPVLPSKEEFPYVIRVVSEVLSSNGSTSMGSVCGSTLALMDAGVPIKKPVSGAAMGLIRE
GDEYRVLTDIQGIEDFLGDMDFKVAGTDQGITALQMDMKIHGLPLEIIADAINQAKPARL
HILNKMLEAIATPRADLSTYAPRLFRIQINPEQIGLVIGPGGKTIRSITEQTGAKIDIED
TGAVTISAVDADSALRAKSIIEGMTRTITAGDVYIGKVTRIIPIGAFVEFLPGKEGMIHI
SQIADYRVARVEDELTVGDEVVVKVREIDQKGRVNLTRKGIDPEEVSAARAAVEAS
Download sequence
Identical sequences Q31KE9
1140.Synpcc7942_2440 WP_011378463.1.45845 WP_011378463.1.95485 gi|81301249|ref|YP_401457.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]