SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81301273|ref|YP_401481.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301273|ref|YP_401481.1|
Domain Number 1 Region: 10-225
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.77e-55
Family NanE-like 0.0000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81301273|ref|YP_401481.1|
Sequence length 232
Comment N-acetylmannosamine-6-phosphate 2-epimerase [Synechococcus elongatus PCC 7942]
Sequence
MDRQQQLRRLQGGLIVSCQAPADSPLHQPEIIAAIAVAAVQRGAVGIRLDTPEHVRAVRD
RLPETPIIGLWKRTFPDSSVYITPRYVEAEAIAAAGADIVALDCTLRPRPDGEDFCQIIP
RLQQELGCAVMADIDTLEAAIAAAKAGADLVGTTLYGYTEATQGQTPPGWDLLETAAQQL
PNTPVICEGGIASAQAARQACDRGAFAVVVGTAITGIDLQVQAYVTALNARP
Download sequence
Identical sequences Q31KC5 Q5N1J0
WP_011243950.1.45845 WP_011243950.1.5740 WP_011243950.1.95485 gi|81301273|ref|YP_401481.1| gi|56751649|ref|YP_172350.1| 1140.Synpcc7942_2464 269084.syc1640_d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]