SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81301317|ref|YP_401525.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301317|ref|YP_401525.1|
Domain Number 1 Region: 7-195
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.77e-26
Family FAD/NAD-linked reductases, N-terminal and central domains 0.036
Further Details:      
 
Domain Number 2 Region: 151-325
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000301
Family FAD/NAD-linked reductases, N-terminal and central domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81301317|ref|YP_401525.1|
Sequence length 398
Comment type 2 NADH dehydrogenase NdbB [Synechococcus elongatus PCC 7942]
Sequence
MVSANSAICILGGGFGGLYTALALAQQSWQGASRPPIHLIDRGDRFVFLPLLYELITGEL
QGWEVAPRYRDLLANTPVQFHRGVVSEVDLQQQLVVLESGQVFEFGQLVLALGGETPRDL
APGAETHALPFRSLDDAIALNTRLSELEHQPDRQIRIAIVGAGPSGVELACKLADRLGDR
AWIRLIELGEDILRNSPEFNREAAERALQQRQILLDLKTGVAAVEADAIVLQRGEQTERL
SNIDLVLWTVGNRVPAAVAALDLPKNARGQLQTALTLQISGHNNLFALGDLAELPLVDGK
AIPATAQAAFQQANCLAANLIAQRREQPLSDFQYQALGEMLALGSGNATLTGLGLTLEGP
LAAVARRLAYLYRMPTPTQQCRVGLNWLLQPLDSLLHS
Download sequence
Identical sequences A0A0H3K6N6 Q935X8
gi|81301317|ref|YP_401525.1| 1140.Synpcc7942_2508 269084.syc1598_c WP_011243908.1.45845 WP_011243908.1.5740 WP_011243908.1.95485 SnR65 gi|56751607|ref|YP_172308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]