SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81301340|ref|YP_401548.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301340|ref|YP_401548.1|
Domain Number 1 Region: 57-199
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.44e-49
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000105
Further Details:      
 
Domain Number 2 Region: 4-55
Classification Level Classification E-value
Superfamily UBA-like 3.23e-20
Family TS-N domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81301340|ref|YP_401548.1|
Sequence length 221
Comment elongation factor Ts [Synechococcus elongatus PCC 7942]
Sequence
MAEISAKLVKELREKTGAGMMDCKKALNENDGDLQKAIEWLRQKGIASAEKKSGRTAAEG
LVGSYIHTGGRVGVLVEVNCETDFVARGDKFQELVRSIAMQIAACPNVEFVKVEDIPAEI
AEREKAIEMGRDDLANKPENIREKIVVGRIEKRLKELTLLDQPYIRDPNISVAELVKQSI
AELGENIQVRRFTRFVLGEGIEKAESDFAAEVAAQAAAAQS
Download sequence
Identical sequences Q31K58 Q5N1Q1
WP_011243889.1.45845 WP_011243889.1.5740 WP_011243889.1.95485 gi|56751588|ref|YP_172289.1| 1140.Synpcc7942_2531 269084.syc1579_c gi|81301340|ref|YP_401548.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]