SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81301378|ref|YP_401586.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301378|ref|YP_401586.1|
Domain Number 1 Region: 7-237
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.42e-67
Family Decarboxylase 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81301378|ref|YP_401586.1|
Sequence length 240
Comment orotidine 5'-phosphate decarboxylase [Synechococcus elongatus PCC 7942]
Sequence
MTDLAARDRIIVPLDVPDVEAAITLIDRLPEAQFFKVGLELFVATGSTVLTILKERQKKI
FLDLKLHDIPNTMAGACRSAARYGVDLLTIHATAGKPALEAAQAGAIAGAAAAGVQPPTL
LAVTVLTSLSQQQLTEELHVPEAVPNYVQHLARQAEACGIGGCVCSPQELVVLKTACSDD
FVRVTPGVRPTWAAAGDQQRVMTPQQAIAAGATYLVVGRPITAADDPAAAFQRVCEELTP
Download sequence
Identical sequences Q31K20 Q5N1T9
1140.Synpcc7942_2569 269084.syc1541_d WP_011243851.1.45845 WP_011243851.1.5740 WP_011243851.1.95485 gi|56751550|ref|YP_172251.1| gi|81301378|ref|YP_401586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]