SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300103|ref|YP_400311.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300103|ref|YP_400311.1|
Domain Number 1 Region: 17-304
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.1e-54
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 396-514
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 3.79e-31
Family Pentapeptide repeats 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300103|ref|YP_400311.1|
Sequence length 522
Comment serine/threonine protein kinase [Synechococcus elongatus PCC 7942]
Sequence
MALCLNPDCGQPNNDDANSSCATCGSPLLLRDRYRVVKAIGQGGFGATYLGQDLQLPGEP
LCVIKQLLPQVQDPEIMLMARELFRREAKTLGRIGSHPQVPTLLDYFEAPEGFYLVQEYI
RGKTLEQEVREQGVYSETATKQFLSELLPLLQYLHNQGVIHRDIKPANLLRRDIDRRLVL
IDFGAVKDQVSQIQGGSGLTALTSFSVGTRGYAPPEQLAMRPVYSSDLYSLGVTCLFLMT
GKGPQDLDYNPVTGELLWRNSVQVSDALATVLGKMLAASVRYRYQRAEQVMTALDLQPYH
DSLIQGLSALPPGAPPIKPSSGRTGSGYPSPQERQAEAIRARRRDRSGNRPEQLADAQQI
AAWTGGTSNTSGNNSAGRLSLNARDILATYQRGRRDFSQQPLNRIDLSESQLPSVNFQGA
QLKESLFVAAQLERADFGQANLHRANLRRANLHQAYFGNADLSFANLQKADLSDAILSNA
NLRGTNLCGANLRGAKLTPVQLKMAKTNWWTILPDGRRGRLF
Download sequence
Identical sequences Q31NP5
gi|81300103|ref|YP_400311.1| 1140.Synpcc7942_1294 NYSGRC-FDAO-ABB57324 SnR201 WP_011377967.1.45845 WP_011377967.1.5740 WP_011377967.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]