SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300896|ref|YP_401104.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300896|ref|YP_401104.1|
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.33e-82
Family Histidine biosynthesis enzymes 0.0000000982
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300896|ref|YP_401104.1|
Sequence length 255
Comment imidazole glycerol phosphate synthase subunit HisF [Synechococcus elongatus PCC 7942]
Sequence
MLAKRILPCLDVKAGRVVKGVNFVDLRDAGDPVELAQAYDAAGADELVFLDIAATHEERQ
ILVDVVYRTAEQVFIPLTVGGGINDLETIRQLLRAGADKVSINSAAVRDPDLIRRASDRF
GSQCIVVAIDARRRTDPDNPGWDVYVRGGRENTGIDALTWAETVARNGAGELLVTSMDAD
GTQAGYDLELTRAIADRVEIPVIASGGAGTCEDIAEAFRTGHAEAALLASLLHYGQLTIA
EIKDHLRSAQIPTRP
Download sequence
Identical sequences Q31LF2
gi|81300896|ref|YP_401104.1| 1140.Synpcc7942_2087 WP_011378309.1.45845 WP_011378309.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]