SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383324353|ref|YP_005385206.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383324353|ref|YP_005385206.1|
Domain Number 1 Region: 12-184,283-402
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.11e-58
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383324353|ref|YP_005385206.1|
Sequence length 414
Comment 2-octaprenyl-6-methoxyphenyl hydroxylase [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MTFVAASITDNQFDVAIAGGGVVGLVLAAGLRHTGLKIAIIEALPKEQALTKPQAYAISL
LSGKILAGLGVWENIKDSIGHFERIQISDNDYRGTVPFAKEDVDELALGHVAEHPVILQA
LENCVEQCPRIAWFRPAELISFTAGENHKQVTLQQEGREITLQTKLLVAADGARSHTRSL
AGIQTKGWKYWQSCVAFTIQHQAPDNTTAFERFCDTGPMGILPLPGDRAQIVWTMPHHKA
HTLVNLPEADFITELRQRIGDRLGEFHLINARRLFPVQLMQSDCYVQPRLALVGDAAHCC
HPVGGQGLNLGIRDGAALAQVIATAHSQGEDWGSLAVLKRYEHWRKPENWLILGFTDLLD
RFFSSHWLPAIALRRFGLEVLRLVPPAKKLALRLMTGLLGRKPQLATGQSLVSQ
Download sequence
Identical sequences L8AGQ1 P72835
gi|383324353|ref|YP_005385206.1| gi|383490237|ref|YP_005407913.1| 1148.slr1300 WP_010871480.1.11876 WP_010871480.1.1889 WP_010871480.1.18904 WP_010871480.1.33690 WP_010871480.1.35395 WP_010871480.1.47586 WP_010871480.1.99424 gi|383321183|ref|YP_005382036.1| gi|16329442|ref|NP_440170.1| gi|16329442|ref|NP_440170.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]